PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA03G01420.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 359aa    MW: 40236.1 Da    PI: 10.4096
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA03G01420.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.97.5e-3095145151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                      krien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++gklye++s
  ONIVA03G01420.2  95 KRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFAS 145
                      79***********************************************86 PP

2K-box69.79.5e-24207300699
            K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                      g+++ +++ e+ + +++ L k++e L++ +R+llGe+L+++s++eL++Le +Le+sl +iR +K++ll eq+ +l++ke +l+++n++Lr+k +
  ONIVA03G01420.2 207 GNKTVQQDIEQVKADADGLAKKLEALETYKRKLLGEKLDECSIEELHSLEVKLERSLISIRGRKTKLLEEQVAKLREKEMKLRKDNEELREKCK 300
                      4557788899*********************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.8E-4187146IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.73587147IPR002100Transcription factor, MADS-box
PROSITE patternPS00350089143IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-3089109IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.11E-2989150IPR002100Transcription factor, MADS-box
CDDcd002653.17E-3689149No hitNo description
PfamPF003194.6E-2796143IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-30109124IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-30124145IPR002100Transcription factor, MADS-box
PfamPF014864.7E-24212300IPR002487Transcription factor, K-box
PROSITE profilePS5129713.413215305IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MTIKNGNATA RTPPVAVCLC LPLPRGGVAT TRTKGNGNTR RDQKGKPRRR GRGEKGEGVG  60
EKEERASSLG YGQTLQRLHH HSLPFLMVRG KTQMKRIENP TSRQVTFSKR RNGLLKKAFE  120
LSVLCDAEVA LIVFSPRGKL YEFASASCRL NSHTTSIKKL VVRLARYVTP KSIYIIKGST  180
SEDVTSALTP LKKTIERYRT YTKENIGNKT VQQDIEQVKA DADGLAKKLE ALETYKRKLL  240
GEKLDECSIE ELHSLEVKLE RSLISIRGRK TKLLEEQVAK LREKEMKLRK DNEELREKCK  300
NQPPLSAPLT VRAEDENPDR NINTTNDNMD VETELFIGLP GRSRSSGGAA EDSQAMPHS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J1e-1789188287Myocyte-specific enhancer factor 2A
3p57_I1e-1789188287Myocyte-specific enhancer factor 2A
3p57_D1e-1789188287Myocyte-specific enhancer factor 2A
3p57_C1e-1789188287Myocyte-specific enhancer factor 2A
3p57_B1e-1789188287Myocyte-specific enhancer factor 2A
3p57_A1e-1789188287Myocyte-specific enhancer factor 2A
3kov_J1e-1789188287Myocyte-specific enhancer factor 2A
3kov_I1e-1789188287Myocyte-specific enhancer factor 2A
3kov_B1e-1789188287Myocyte-specific enhancer factor 2A
3kov_A1e-1789188287Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8300370.0CT830037.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA030D10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630979.11e-156PREDICTED: MADS-box transcription factor 50
SwissprotQ9XJ601e-158MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLA0A0E0GG170.0A0A0E0GG17_ORYNI; Uncharacterized protein
STRINGORGLA03G0015400.11e-152(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.11e-62AGAMOUS-like 20